DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5151 and ldlrad4a

DIOPT Version :9

Sequence 1:NP_001246790.1 Gene:CG5151 / 39772 FlyBaseID:FBgn0036576 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_021323969.1 Gene:ldlrad4a / 562665 ZFINID:ZDB-GENE-060503-850 Length:305 Species:Danio rerio


Alignment Length:138 Identity:36/138 - (26%)
Similarity:64/138 - (46%) Gaps:14/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QQTPRCPHHVPLPDSE----YGQDRHLQIRSSYQQSEITRSYTKPPPNKTVRD---VPEQISAGG 254
            ||....|..:.|.|.|    |.....||:|...||.|::|:..:.|||:|:.|   :...:..||
Zfish   162 QQDIHLPPTICLSDGEELPPYKGPCTLQLRDPEQQLELSRASVRAPPNRTIFDSDLIDVYVHGGG 226

  Fly   255 CGVSSSSYRLTTLQAASSTYTPAGVSVSASSSSSKSKPNAITKFFSRISSPKSPPSCTMTSVATA 319
            ....||:    :.::||:::. .|...:.|....::.|.:.:  |....|..:|||...|:..:.
Zfish   227 PRPPSSN----SGKSASNSHV-EGPPPTYSEVMGQTYPGSAS--FLHQHSNNAPPSNQRTASRSG 284

  Fly   320 SPASSVSM 327
            .|.:|.::
Zfish   285 QPGASTTL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5151NP_001246790.1 None
ldlrad4aXP_021323969.1 LDLa 16..47 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.