DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5151 and Ldlrad4

DIOPT Version :9

Sequence 1:	NP_001246790.1	Gene:	CG5151 / 39772	FlyBaseID:	FBgn0036576	Length:	493	Species:	Drosophila melanogaster
Sequence 2:	NP_766219.2	Gene:	Ldlrad4 / 52662	MGIID:	1277150	Length:	306	Species:	Mus musculus

Alignment Length:	143	Identity:	38/143 - (26%)
Similarity:	50/143 - (34%)	Gaps:	46/143 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   196 QQQTPRCPHHVPLP------DSE----YGQDRHLQIRSSYQQSEITRSYTKPPPNKTVRDVP--- 247
            |...|...|.:.||      |.|    |.....||:|...||.|:.|...:.|||:||.|..
Mouse   156 QPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTVFDSDLID 220

  Fly   248 -EQISAGGCGVSSSSYRLTTLQAASSTYTPAGVSVSASSSSSKSKPNAITKFFSRISSPKSPPSC 311
             ...:.|.|..||.|                |:|.:..||:            .|:..|  ||
Mouse   221 ISMYNGGPCPPSSHS----------------GISAATCSSN------------GRMEGP--PP-- 253

  Fly   312 TMTSVATASPASS 324
            |.:.|....|.:|
Mouse   254 TYSEVMGHYPGTS 266

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5151	NP_001246790.1	None
Ldlrad4	NP_766219.2	LDLa	16..47	CDD:238060
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	100..127
		PPxY motif 1	180..183		0/2 (0%)
		SMAD interaction motif (SIM)	208..211		2/2 (100%)
		PPxY motif 2	252..255		2/4 (50%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	268..306
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167848783
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930