DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5151 and pmepa1

DIOPT Version :9

Sequence 1:NP_001246790.1 Gene:CG5151 / 39772 FlyBaseID:FBgn0036576 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001002580.1 Gene:pmepa1 / 436853 ZFINID:ZDB-GENE-040718-320 Length:209 Species:Danio rerio


Alignment Length:148 Identity:33/148 - (22%)
Similarity:50/148 - (33%) Gaps:61/148 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 SSCSSLQSHSNDHHQHY----------------QYQLQQQQTPRCPHHVP--------------- 207
            |:.|.:..|:::..:|.                ...:.:..|||.|..||               
Zfish    67 SARSLMSRHTHERRRHLPLPSEGSLWSSDGPGSSSAMSEVYTPRAPDRVPSFLQRERVSRFQPTF 131

  Fly   208 --------------LPDSE----YGQDRHLQIRSSYQQSEITRSYTKPPPNKTVRDVPEQISAGG 254
                          |.|.|    |.....||:|...||.|:.|...:||||:||.|         
Zfish   132 PFLPPVIELPPTIALSDGEEPPPYQGPCTLQLRDREQQLELNRESVRPPPNRTVYD--------- 187

  Fly   255 CGVSSSSYRLTTLQAASS 272
               |:.::..|.:||.|:
Zfish   188 ---SALTHTHTLIQARST 202



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.