DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5151 and Pmepa1

DIOPT Version :9

Sequence 1:NP_001246790.1 Gene:CG5151 / 39772 FlyBaseID:FBgn0036576 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_006235751.1 Gene:Pmepa1 / 311676 RGDID:1308255 Length:277 Species:Rattus norvegicus


Alignment Length:155 Identity:42/155 - (27%)
Similarity:56/155 - (36%) Gaps:48/155 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 QQQTPRCPHHVPLP------DSE----YGQDRHLQIRSSYQQSEITRSYTKPPPNKTVRD---VP 247
            |...|...|.:.||      |.|    |.....||:|...||.|:.|...:.|||:|:.|   :.
  Rat   128 QPTYPYLQHEIALPPTISLSDGEEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLID 192

  Fly   248 EQISAGGCGVSSSSYRLTTLQAASSTYTPAGVSVSASSSSSKSKPNAITKFFSRISSPKSPPSCT 312
            ..:..|.|..||:|                |:|.:..||.            .|:..|  ||  |
  Rat   193 SSMLGGPCPPSSNS----------------GISATCYSSG------------GRMEGP--PP--T 225

  Fly   313 MTSVATASPASSV---SMSSSASSL 334
            .:.|....|.||.   ..|:..|||
  Rat   226 YSEVIGHYPGSSFQQHQQSNGQSSL 250



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.