DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and SCS7

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_013999.1 Gene:SCS7 / 855315 SGDID:S000004885 Length:384 Species:Saccharomyces cerevisiae


Alignment Length:126 Identity:40/126 - (31%)
Similarity:63/126 - (50%) Gaps:18/126 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLYELSEVAQQNGKNGKPCWLIIKG-NVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAG---H 63
            :|:....|.:.|..|  .||:..:. .:||||:||.|||||.|::|:|.|||.|:..|.:.   |
Yeast    10 ELFSKKTVQEHNTAN--DCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVHEH 72

  Fly    64 SSDAEKDLKN-YKIGEI-----------NSAAPIQVQPTSNGAAKPTANTISEDPEPAKNS 112
            |..|.:.|:: |.||.:           |....::||.:::|....:...:.|.|...|.|
Yeast    73 SDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTFVKELPAEEKLS 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 32/79 (41%)
SCS7NP_013999.1 CYB5 31..224 CDD:227599 34/103 (33%)
FA_hydroxylase 149..380 CDD:412761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.