DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and IRC21

DIOPT Version :10

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_013789.1 Gene:IRC21 / 855095 SGDID:S000004677 Length:201 Species:Saccharomyces cerevisiae


Alignment Length:45 Identity:14/45 - (31%)
Similarity:28/45 - (62%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKD 53
            ::.:::.|.....|.:|.|.|||::.:|..||||::.|:::...|
Yeast   128 KIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 7..79 CDD:459698 14/45 (31%)
IRC21NP_013789.1 Cyt-b5 130..199 CDD:459698 14/43 (33%)

Return to query results.
Submit another query.