DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and CB5LP

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_176265.1 Gene:CB5LP / 842360 AraportID:AT1G60660 Length:121 Species:Arabidopsis thaliana


Alignment Length:76 Identity:31/76 - (40%)
Similarity:49/76 - (64%) Gaps:3/76 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEK 69
            |..||||..|.:|  .||:|||..|||:|.::.||||| :|:|::.|.|:|..|....|::....
plant    49 YSKSEVAVHNKRN--DCWIIIKDKVYDITSYVEEHPGG-DAILDHAGDDSTDGFFGPQHATRVFD 110

  Fly    70 DLKNYKIGEIN 80
            .::::.|||::
plant   111 MIEDFYIGELH 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 30/73 (41%)
CB5LPNP_176265.1 Cyt-b5 50..121 CDD:395121 30/73 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.