DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and CB5-A

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_173958.1 Gene:CB5-A / 839176 AraportID:AT1G26340 Length:135 Species:Arabidopsis thaliana


Alignment Length:83 Identity:36/83 - (43%)
Similarity:56/83 - (67%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSS 65
            :::||.:.|.|..|.::  .||::|.|.||||:.::.|||||.:.||...|||||..|:.||||.
plant     4 LTKLYSMEEAATHNKQD--DCWVVIDGKVYDVSSYMDEHPGGDDVLLAVAGKDATDDFEDAGHSK 66

  Fly    66 DAEKDLKNYKIGEINSAA 83
            ||.:.::.|.|||::.::
plant    67 DARELMEKYFIGELDESS 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 35/74 (47%)
CB5-ANP_173958.1 Cyt-b5 9..81 CDD:395121 34/73 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.