DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and CYB5B

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_085056.2 Gene:CYB5B / 80777 HGNCID:24374 Length:150 Species:Homo sapiens


Alignment Length:113 Identity:52/113 - (46%)
Similarity:68/113 - (60%) Gaps:17/113 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEK 69
            |.|.|||::|..  |..||:|.|.|||||:||.|||||.|.|||..|.||:::|:..||||||.:
Human    27 YRLEEVAKRNSL--KELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDARE 89

  Fly    70 DLKNYKIGEINSAAPIQVQPTSNGAAKPTANTISEDPEPAKNSSSGFC 117
            .||.|.||:|:   |..::|.|.          |:|  |:||.:...|
Human    90 MLKQYYIGDIH---PSDLKPESG----------SKD--PSKNDTCKSC 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 42/73 (58%)
CYB5BNP_085056.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyt-b5 28..100 CDD:365921 41/73 (56%)
MIP <123..148 CDD:350945 52/113 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.