DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and Cyb5b

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_085075.1 Gene:Cyb5b / 80773 RGDID:621551 Length:146 Species:Rattus norvegicus


Alignment Length:109 Identity:46/109 - (42%)
Similarity:65/109 - (59%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEK 69
            |.|.|||::|  ..:..|::|.|.|||:|:||.|||||.|.|||..|.|||::|:..|||.||.:
  Rat    23 YRLEEVAKRN--TAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDARE 85

  Fly    70 DLKNYKIGEINSAAPIQVQPTSNGAAKPTANTISEDPEPAKNSS 113
            .||.|.||:::   |..::|...            |.:|:||:|
  Rat    86 MLKQYYIGDVH---PNDLKPKDG------------DKDPSKNNS 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 39/73 (53%)
Cyb5bNP_085075.1 Cyt-b5 22..95 CDD:278597 39/73 (53%)
MIP <109..139 CDD:294134 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19359
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.