DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and FA2H

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_077282.3 Gene:FA2H / 79152 HGNCID:21197 Length:372 Species:Homo sapiens


Alignment Length:98 Identity:24/98 - (24%)
Similarity:46/98 - (46%) Gaps:11/98 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAF--KQAGHSSDAEKDLKNYKIGEINSA- 82
            ||:.....:||::.|:..||||.:.|....|:|.:...  ....||::|.:.|:.|.:||:... 
Human    25 CWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQ 89

  Fly    83 ------APIQVQPT--SNGAAKPTANTISEDPE 107
                  .|:.::.|  ::.|.:|....:..|.:
Human    90 QGSMENEPVALEETQKTDPAMEPRFKVVDWDKD 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 18/59 (31%)
FA2HNP_077282.3 Cyt-b5 15..85 CDD:278597 18/59 (31%)
FA_hydroxylase 124..366 CDD:294712
ERG3 <210..367 CDD:225546
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.