DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and Cyb5b

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_079834.2 Gene:Cyb5b / 66427 MGIID:1913677 Length:146 Species:Mus musculus


Alignment Length:109 Identity:46/109 - (42%)
Similarity:67/109 - (61%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEK 69
            |.|.|||::|  :.:..|::|.|.|||:|:||.|||||.|.|||..|.|||::|:..|||.||.:
Mouse    23 YRLEEVAKRN--SAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDARE 85

  Fly    70 DLKNYKIGEINSAAPIQVQPTSNGAAKPTANTISEDPEPAKNSS 113
            .||.|.||:::   |..::|.            .:|.:|:||:|
Mouse    86 MLKQYYIGDVH---PSDLKPK------------GDDKDPSKNNS 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 39/73 (53%)
Cyb5bNP_079834.2 Cyt-b5 22..95 CDD:278597 39/73 (53%)
MIP <119..139 CDD:294134
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.