DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and Cyb5a

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_071581.1 Gene:Cyb5a / 64001 RGDID:620558 Length:134 Species:Rattus norvegicus


Alignment Length:99 Identity:42/99 - (42%)
Similarity:57/99 - (57%) Gaps:9/99 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEK 69
            |.|.|:  |..|:.|..|:|:...|||:||||.|||||.|.|.|..|.|||:.|:..|||:||.:
  Rat    12 YTLEEI--QKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARE 74

  Fly    70 DLKNYKIGEINSAAPIQVQPTSNGAAKPTANTIS 103
            ..|.|.|||::.....::       |||:...|:
  Rat    75 LSKTYIIGELHPDDRSKI-------AKPSETLIT 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 37/73 (51%)
Cyb5aNP_071581.1 Cyt-b5 13..85 CDD:395121 37/73 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.