DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and CYB5R4

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_057314.2 Gene:CYB5R4 / 51167 HGNCID:20147 Length:521 Species:Homo sapiens


Alignment Length:77 Identity:24/77 - (31%)
Similarity:40/77 - (51%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDA 67
            :|.|::|...:.......||:.|:|.||:|:.::..||||.:.|:...|.|.|:.|.|.....:.
Human    53 RLIEVTEEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNY 117

  Fly    68 EKDLKNYKIGEI 79
            |..||...:|.:
Human   118 ESMLKECLVGRM 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 24/74 (32%)
CYB5R4NP_057314.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Cyt-b5 58..130 CDD:306642 22/72 (31%)
p23_NCB5OR 170..256 CDD:107240
cyt_b5_reduct_like 278..519 CDD:99780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.