DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and cyb5a

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_998300.2 Gene:cyb5a / 406409 ZFINID:ZDB-GENE-040426-2148 Length:137 Species:Danio rerio


Alignment Length:76 Identity:39/76 - (51%)
Similarity:51/76 - (67%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEK 69
            |.||||.::|  :.|..|:||...||||||||.|||||.|.|.|..|.|||::|:..|||:||.:
Zfish    14 YRLSEVEERN--SFKSTWIIIHNKVYDVTKFLEEHPGGEEVLREQAGGDATESFEDVGHSTDARE 76

  Fly    70 DLKNYKIGEIN 80
            ...:..|||::
Zfish    77 MASSMLIGEVH 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 38/73 (52%)
cyb5aNP_998300.2 Cyt-b5 15..87 CDD:306642 38/73 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.