powered by:
Protein Alignment CG5157 and Cyb5d1
DIOPT Version :9
Sequence 1: | NP_648843.1 |
Gene: | CG5157 / 39771 |
FlyBaseID: | FBgn0036575 |
Length: | 119 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001178819.1 |
Gene: | Cyb5d1 / 363629 |
RGDID: | 1559567 |
Length: | 228 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 19/69 - (27%) |
Similarity: | 32/69 - (46%) |
Gaps: | 10/69 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 SEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGG--SEALLEYGGKDATKAFKQAGHSSDAEKD 70
||||:.| ..:..|:...|.||::|..:.|..|. .:.:||..|:|.:..| ....||
Rat 23 SEVAEHN--QPEDLWVSYLGFVYNLTPLVQEFKGDLLLKPILEVAGQDISHWF------DPKTKD 79
Fly 71 LKNY 74
::.:
Rat 80 IRKH 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5157 | NP_648843.1 |
Cyt-b5 |
4..79 |
CDD:278597 |
19/69 (28%) |
Cyb5d1 | NP_001178819.1 |
Cyt-b5 |
19..>73 |
CDD:278597 |
16/51 (31%) |
UBQ |
143..199 |
CDD:214563 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5274 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.