powered by:
Protein Alignment CG5157 and CG15429
DIOPT Version :9
Sequence 1: | NP_648843.1 |
Gene: | CG5157 / 39771 |
FlyBaseID: | FBgn0036575 |
Length: | 119 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_608823.2 |
Gene: | CG15429 / 33637 |
FlyBaseID: | FBgn0031596 |
Length: | 215 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 22/62 - (35%) |
Similarity: | 29/62 - (46%) |
Gaps: | 6/62 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 YELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEY----GGKDATKAFKQAG 62
|...||...|.|: .||:||..|:||:|..|.:........|:| .|||.|..|.:.|
Fly 11 YLKDEVVSHNKKD--DCWVIIHRNIYDLTPMLKDRFDNWNRTLDYLVAHAGKDLTHFFHENG 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5274 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.