DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and oca8

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_587997.1 Gene:oca8 / 2538772 PomBaseID:SPCC16A11.10c Length:129 Species:Schizosaccharomyces pombe


Alignment Length:103 Identity:35/103 - (33%)
Similarity:59/103 - (57%) Gaps:2/103 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEKDL 71
            :.||.:.|.::  ..::::|..|||::|||..||||.|.|::..|:||:..|:..|||.||::.|
pombe     8 VEEVLKHNTRD--DLYIVVKDKVYDISKFLDAHPGGEEVLVDLAGRDASGPFEDVGHSEDAQELL 70

  Fly    72 KNYKIGEINSAAPIQVQPTSNGAAKPTANTISEDPEPA 109
            :.:.||.:.........||:..||..:....|:..:||
pombe    71 EKFYIGNLLRTEDGPQLPTTGAAAGGSGYDSSQPVKPA 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 28/71 (39%)
oca8NP_587997.1 CYB5 <2..128 CDD:227599 35/103 (34%)
Cyt-b5 5..78 CDD:278597 28/71 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.