DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5157 and cytb-5.1

DIOPT Version :9

Sequence 1:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_510335.2 Gene:cytb-5.1 / 181510 WormBaseID:WBGene00007848 Length:134 Species:Caenorhabditis elegans


Alignment Length:73 Identity:38/73 - (52%)
Similarity:46/73 - (63%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEKDL 71
            |.|:|:.|  ..|..||:|...|:||||||.|||||.|.|||..|.|.|:||:..|||:||....
 Worm     9 LKEIAEHN--TNKSAWLVIGNKVFDVTKFLDEHPGGCEVLLEQAGSDGTEAFEDVGHSTDARHMK 71

  Fly    72 KNYKIGEI 79
            ..|.|||:
 Worm    72 DEYLIGEV 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5157NP_648843.1 Cyt-b5 4..79 CDD:278597 37/71 (52%)
cytb-5.1NP_510335.2 Cyt-b5 8..80 CDD:365921 38/73 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.