powered by:
Protein Alignment CG5157 and cytb-5.1
DIOPT Version :9
Sequence 1: | NP_648843.1 |
Gene: | CG5157 / 39771 |
FlyBaseID: | FBgn0036575 |
Length: | 119 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_510335.2 |
Gene: | cytb-5.1 / 181510 |
WormBaseID: | WBGene00007848 |
Length: | 134 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 38/73 - (52%) |
Similarity: | 46/73 - (63%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 LSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEKDL 71
|.|:|:.| ..|..||:|...|:||||||.|||||.|.|||..|.|.|:||:..|||:||....
Worm 9 LKEIAEHN--TNKSAWLVIGNKVFDVTKFLDEHPGGCEVLLEQAGSDGTEAFEDVGHSTDARHMK 71
Fly 72 KNYKIGEI 79
..|.|||:
Worm 72 DEYLIGEV 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5274 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1566561at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000784 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.