DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elg1 and ligA

DIOPT Version :9

Sequence 1:NP_996103.1 Gene:elg1 / 39770 FlyBaseID:FBgn0036574 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_416906.1 Gene:ligA / 946885 ECOCYCID:EG10534 Length:671 Species:Escherichia coli


Alignment Length:335 Identity:70/335 - (20%)
Similarity:110/335 - (32%) Gaps:100/335 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 RLADEARGEFIELQMEQRAKRLRKMLTKTDAKEVTAPSSAPT-DPTVKRLRGRPRSRRISSMDAQ 285
            |.|.:...:.:.:.:.:|.:         |.:||..|:..|. ...|:|:.|...:|....:...
E. coli   378 RRAGDVIPQVVNVVLSERPE---------DTREVVFPTHCPVCGSDVERVEGEAVARCTGGLICG 433

  Fly   286 NQIVESKPPVV--KAKDQDPGTEELLSKL------SSPTKKRDSLLGYFPKVE--SPKELAEKVI 340
            .|..||....|  :|.|.|...::::.:|      .:|........|....:|  .||. |:.|:
E. coli   434 AQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMGPKS-AQNVV 497

  Fly   341 IAIETPPMETPKRRTLRRKSQQETPIVAESTPSSRPRRSCVGKARYDYDLETSPGKQQKAKPQKA 405
            .|:| ...||...|.|.....:|   |.|:|        ..|.|.|...||             |
E. coli   498 NALE-KAKETTFARFLYALGIRE---VGEAT--------AAGLAAYFGTLE-------------A 537

  Fly   406 DESVEIIDLDNSNPAATPKKLAPLFVRQLPKPSPDPSVLKARQA---------------FLQSGV 455
            .|:..|.:|                     :..||..::.|...               .|..||
E. coli   538 LEAASIEEL---------------------QKVPDVGIVVASHVHNFFAEESNRNVISELLAEGV 581

  Fly   456 ----PDKIRQEQIRQK----------NFDQMYEDSYEVFPRLAHIGCESFGSKNGPLDIPFALRA 506
                |..|..|:|...          :..||..|..:.  ||..:|.:..||.:...|:..|  .
E. coli   582 HWPAPIVINAEEIDSPFAGKTVVLTGSLSQMSRDDAKA--RLVELGAKVAGSVSKKTDLVIA--G 642

  Fly   507 EEEYSEVTKA 516
            |...|::.||
E. coli   643 EAAGSKLAKA 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elg1NP_996103.1 Selenoprotein_S <57..129 CDD:284376
P-loop_NTPase 699..828 CDD:304359
ligANP_416906.1 ligA 1..670 CDD:236137 70/335 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23389
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.