DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elg1 and CRLF3

DIOPT Version :9

Sequence 1:NP_996103.1 Gene:elg1 / 39770 FlyBaseID:FBgn0036574 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_057070.3 Gene:CRLF3 / 51379 HGNCID:17177 Length:442 Species:Homo sapiens


Alignment Length:114 Identity:21/114 - (18%)
Similarity:43/114 - (37%) Gaps:27/114 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LRAPPSAKSKLILQNMEEVLNSVKQKHREKHKRKREEKRRAALMEDQKSTTEEVKANAKEKPQPL 106
            :|.....:.:|:||...|.:.:.:...||...|          :|..:....::|.:|.:....|
Human     1 MRGAMELEPELLLQEARENVEAAQSYRRELGHR----------LEGLREARRQIKESASQTRDVL 55

  Fly   107 REKSSQENGLKN--GRRRSSPL------------KSSTPVADNQSIMKH 141
            ::   ..|.||.  |:.....|            ::..|:.|.|.:::|
Human    56 KQ---HFNDLKGTLGKLLDERLVTLLQEVDTIEQETIKPLDDCQKLIEH 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elg1NP_996103.1 Selenoprotein_S <57..129 CDD:284376 13/85 (15%)
P-loop_NTPase 699..828 CDD:304359
CRLF3NP_057070.3 FN3 181..265 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.