DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs20 and TRS20

DIOPT Version :9

Sequence 1:NP_648841.1 Gene:Trs20 / 39769 FlyBaseID:FBgn0266724 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_009813.1 Gene:TRS20 / 852556 SGDID:S000000458 Length:175 Species:Saccharomyces cerevisiae


Alignment Length:170 Identity:51/170 - (30%)
Similarity:88/170 - (51%) Gaps:37/170 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFVIVGQNDNPIYEKEFSTV-NKELRKEDHRHLTQFIAHAALDLVDEHKWK-------------- 54
            ||.|:|:.|||:||.||:.. |.:...:|.:.|..||.||:||:|::.:|:              
Yeast     4 YFAIIGKKDNPVYEIEFTNAENPQGFPQDLKELNPFILHASLDIVEDLQWQINPTSQLNGNGGNG 68

  Fly    55 ---------------TANMQLKSIDRFNQWFVSAFITASQIRFIIVHDNK-------NDEGIKNF 97
                           |.|..|..:|.|....::|:|:.|.::|:::|.|.       :|..:::|
Yeast    69 SNGGGGFLRSRAVNNTDNCYLGKVDHFYGLAITAYISYSGMKFVMIHGNSANSSVVIDDNNMRSF 133

  Fly    98 FNEMYDTYIKNSMNAFYRINTPIKSPMFEKKSEIFGRKYL 137
            :.|:::.|:|..||.||:|..||:||.|:.:.....||:|
Yeast   134 YQEVHELYVKTLMNPFYKITDPIRSPAFDSRVRTLARKHL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs20NP_648841.1 Sedlin_N 8..135 CDD:282482 46/163 (28%)
TRS20NP_009813.1 TRS20 1..173 CDD:227890 50/168 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I1865
eggNOG 1 0.900 - - E1_COG5603
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5436
Inparanoid 1 1.050 95 1.000 Inparanoid score I1505
Isobase 1 0.950 - 0 Normalized mean entropy S776
OMA 1 1.010 - - QHG54366
OrthoFinder 1 1.000 - - FOG0002766
OrthoInspector 1 1.000 - - oto99884
orthoMCL 1 0.900 - - OOG6_102292
Panther 1 1.100 - - LDO PTHR12403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1554
SonicParanoid 1 1.000 - - X1852
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.