DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs20 and AT1G80500

DIOPT Version :9

Sequence 1:NP_648841.1 Gene:Trs20 / 39769 FlyBaseID:FBgn0266724 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001320643.1 Gene:AT1G80500 / 844389 AraportID:AT1G80500 Length:135 Species:Arabidopsis thaliana


Alignment Length:136 Identity:62/136 - (45%)
Similarity:87/136 - (63%) Gaps:3/136 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STYYFVIVGQNDNPIYEKEFSTVNKELRKEDHRHLTQFIAHAALDLVDEHKWKTANMQLKSIDRF 66
            :|..|:|||:||.||||.|   |....::||...|.|||.|||||:|.:..|.|:.|.|||:|||
plant     3 NTACFIIVGRNDIPIYEAE---VGSAAKREDAAQLHQFILHAALDVVQDLAWTTSAMFLKSVDRF 64

  Fly    67 NQWFVSAFITASQIRFIIVHDNKNDEGIKNFFNEMYDTYIKNSMNAFYRINTPIKSPMFEKKSEI 131
            |...||.::||...|.:::||::|::|||:||.|:::.|||..:|..|...:.|.|..|:.|...
plant    65 NDLVVSVYVTAGHTRLMLLHDSRNEDGIKSFFQEVHELYIKILLNPLYLPGSRITSSHFDTKVRA 129

  Fly   132 FGRKYL 137
            ..||||
plant   130 LARKYL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs20NP_648841.1 Sedlin_N 8..135 CDD:282482 56/126 (44%)
AT1G80500NP_001320643.1 Sedlin_N 9..133 CDD:309669 56/126 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 113 1.000 Domainoid score I2046
eggNOG 1 0.900 - - E1_COG5603
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5436
Inparanoid 1 1.050 123 1.000 Inparanoid score I1961
OMA 1 1.010 - - QHG54366
OrthoDB 1 1.010 - - D1426075at2759
OrthoFinder 1 1.000 - - FOG0002766
OrthoInspector 1 1.000 - - oto4118
orthoMCL 1 0.900 - - OOG6_102292
Panther 1 1.100 - - LDO PTHR12403
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1852
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.