DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs20 and trappc2

DIOPT Version :9

Sequence 1:NP_648841.1 Gene:Trs20 / 39769 FlyBaseID:FBgn0266724 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001307044.1 Gene:trappc2 / 767808 ZFINID:ZDB-GENE-060929-1266 Length:140 Species:Danio rerio


Alignment Length:137 Identity:79/137 - (57%)
Similarity:109/137 - (79%) Gaps:0/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYYFVIVGQNDNPIYEKEFSTVNKELRKEDHRHLTQFIAHAALDLVDEHKWKTANMQLKSIDRFN 67
            ::|||:||.:|||::|.||....|...|:|||||.|||||||||||||:.|.:.||.||::|:||
Zfish     4 SFYFVMVGHHDNPVFELEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFN 68

  Fly    68 QWFVSAFITASQIRFIIVHDNKNDEGIKNFFNEMYDTYIKNSMNAFYRINTPIKSPMFEKKSEIF 132
            :||||||:||..:|||::||.:.::|||||||::||.|:|.:||.||.:|.||:|..||:|.:..
Zfish    69 EWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFNDVYDLYVKFAMNPFYEVNAPIRSTAFERKVQFL 133

  Fly   133 GRKYLLS 139
            |:|:|||
Zfish   134 GKKHLLS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs20NP_648841.1 Sedlin_N 8..135 CDD:282482 72/126 (57%)
trappc2NP_001307044.1 Sedlin_N 10..136 CDD:282482 72/125 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3825
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5436
Inparanoid 1 1.050 183 1.000 Inparanoid score I3959
OMA 1 1.010 - - QHG54366
OrthoDB 1 1.010 - - D1426075at2759
OrthoFinder 1 1.000 - - FOG0002766
OrthoInspector 1 1.000 - - oto40811
orthoMCL 1 0.900 - - OOG6_102292
Panther 1 1.100 - - LDO PTHR12403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1554
SonicParanoid 1 1.000 - - X1852
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.