DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs20 and Trappc2

DIOPT Version :9

Sequence 1:NP_648841.1 Gene:Trs20 / 39769 FlyBaseID:FBgn0266724 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_079708.2 Gene:Trappc2 / 66226 MGIID:1913476 Length:140 Species:Mus musculus


Alignment Length:137 Identity:79/137 - (57%)
Similarity:108/137 - (78%) Gaps:0/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYYFVIVGQNDNPIYEKEFSTVNKELRKEDHRHLTQFIAHAALDLVDEHKWKTANMQLKSIDRFN 67
            ::||||||.:|||::|.||....|...|:|||||.|||||||||||||:.|.:.||.||::|:||
Mouse     4 SFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFN 68

  Fly    68 QWFVSAFITASQIRFIIVHDNKNDEGIKNFFNEMYDTYIKNSMNAFYRINTPIKSPMFEKKSEIF 132
            :||||||:||..:|||::||.:.::||||||.::||.|||.:||.||..|:||:|..|::|.:..
Mouse    69 EWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKVQFL 133

  Fly   133 GRKYLLS 139
            |:|:|||
Mouse   134 GKKHLLS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs20NP_648841.1 Sedlin_N 8..135 CDD:282482 72/126 (57%)
Trappc2NP_079708.2 TRAPPC2_sedlin 4..138 CDD:341429 76/133 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850692
Domainoid 1 1.000 164 1.000 Domainoid score I3928
eggNOG 1 0.900 - - E1_COG5603
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5436
Inparanoid 1 1.050 180 1.000 Inparanoid score I3985
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54366
OrthoDB 1 1.010 - - D1426075at2759
OrthoFinder 1 1.000 - - FOG0002766
OrthoInspector 1 1.000 - - otm43717
orthoMCL 1 0.900 - - OOG6_102292
Panther 1 1.100 - - LDO PTHR12403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1554
SonicParanoid 1 1.000 - - X1852
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.