DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs20 and sedl-1

DIOPT Version :9

Sequence 1:NP_648841.1 Gene:Trs20 / 39769 FlyBaseID:FBgn0266724 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_508272.1 Gene:sedl-1 / 180478 WormBaseID:WBGene00021046 Length:141 Species:Caenorhabditis elegans


Alignment Length:140 Identity:76/140 - (54%)
Similarity:106/140 - (75%) Gaps:3/140 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MST--YYFVIVGQNDNPIYEKEFSTVNKELRK-EDHRHLTQFIAHAALDLVDEHKWKTANMQLKS 62
            |:|  :||.|:|..|.||:|.:|....|:.:: |..|||..:|.|||||:||||...|:.|.||.
 Worm     1 MATKEFYFAIIGHCDQPIFEMDFPVGEKKTKESEGTRHLNHYIGHAALDIVDEHALTTSQMYLKM 65

  Fly    63 IDRFNQWFVSAFITASQIRFIIVHDNKNDEGIKNFFNEMYDTYIKNSMNAFYRINTPIKSPMFEK 127
            :|:||:|:||||:|||:||||::|.::.|||||.||.|||:||||::||.||.|:..|:||.||:
 Worm    66 VDKFNEWYVSAFVTASRIRFIMLHTHRADEGIKQFFQEMYETYIKHAMNPFYEIDDVIESPAFEQ 130

  Fly   128 KSEIFGRKYL 137
            |:.::|||||
 Worm   131 KATLYGRKYL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs20NP_648841.1 Sedlin_N 8..135 CDD:282482 68/127 (54%)
sedl-1NP_508272.1 Sedlin_N 10..138 CDD:282482 68/127 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 151 1.000 Domainoid score I2691
eggNOG 1 0.900 - - E1_COG5603
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5436
Inparanoid 1 1.050 163 1.000 Inparanoid score I2825
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54366
OrthoDB 1 1.010 - - D1426075at2759
OrthoFinder 1 1.000 - - FOG0002766
OrthoInspector 1 1.000 - - oto19067
orthoMCL 1 0.900 - - OOG6_102292
Panther 1 1.100 - - LDO PTHR12403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1554
SonicParanoid 1 1.000 - - X1852
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.870

Return to query results.
Submit another query.