DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs20 and TRAPPC2B

DIOPT Version :9

Sequence 1:NP_648841.1 Gene:Trs20 / 39769 FlyBaseID:FBgn0266724 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001342133.1 Gene:TRAPPC2B / 10597 HGNCID:10710 Length:140 Species:Homo sapiens


Alignment Length:137 Identity:80/137 - (58%)
Similarity:108/137 - (78%) Gaps:0/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYYFVIVGQNDNPIYEKEFSTVNKELRKEDHRHLTQFIAHAALDLVDEHKWKTANMQLKSIDRFN 67
            ::||||||.:|||::|.||....|...|:|||||.|||||||||||||:.|.:.||.||::|:||
Human     4 SFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFN 68

  Fly    68 QWFVSAFITASQIRFIIVHDNKNDEGIKNFFNEMYDTYIKNSMNAFYRINTPIKSPMFEKKSEIF 132
            :||||||:||..:|||::||.:.::||||||.::||.|||.|||.||..|:||:|..|::|.:..
Human    69 EWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFL 133

  Fly   133 GRKYLLS 139
            |:|:|||
Human   134 GKKHLLS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs20NP_648841.1 Sedlin_N 8..135 CDD:282482 73/126 (58%)
TRAPPC2BNP_001342133.1 TRAPPC2_sedlin 4..138 CDD:341429 77/133 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160340
Domainoid 1 1.000 166 1.000 Domainoid score I3891
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3997
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54366
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002766
OrthoInspector 1 1.000 - - otm41671
orthoMCL 1 0.900 - - OOG6_102292
Panther 1 1.100 - - LDO PTHR12403
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1554
SonicParanoid 1 1.000 - - X1852
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.