DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs20 and Trappc2b

DIOPT Version :9

Sequence 1:NP_648841.1 Gene:Trs20 / 39769 FlyBaseID:FBgn0266724 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001258040.1 Gene:Trappc2b / 100910318 RGDID:6499350 Length:140 Species:Rattus norvegicus


Alignment Length:137 Identity:78/137 - (56%)
Similarity:107/137 - (78%) Gaps:0/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYYFVIVGQNDNPIYEKEFSTVNKELRKEDHRHLTQFIAHAALDLVDEHKWKTANMQLKSIDRFN 67
            ::||||||.:|||::|.||....|...|::||||.|||||||||||||:.|.:.||.||::|:||
  Rat     4 SFYFVIVGHHDNPVFEMEFLPAGKTESKDEHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFN 68

  Fly    68 QWFVSAFITASQIRFIIVHDNKNDEGIKNFFNEMYDTYIKNSMNAFYRINTPIKSPMFEKKSEIF 132
            :||||||:||..:|.|::||.:.::||||||.::||.|||.:||.||..|:||:|..||:|.:..
  Rat    69 EWFVSAFVTAGHMRLIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSTAFERKVQFL 133

  Fly   133 GRKYLLS 139
            |:|:|||
  Rat   134 GKKHLLS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs20NP_648841.1 Sedlin_N 8..135 CDD:282482 71/126 (56%)
Trappc2bNP_001258040.1 Sedlin_N 9..136 CDD:282482 71/126 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I3850
eggNOG 1 0.900 - - E1_COG5603
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3899
OMA 1 1.010 - - QHG54366
OrthoDB 1 1.010 - - D1426075at2759
OrthoFinder 1 1.000 - - FOG0002766
OrthoInspector 1 1.000 - - otm45794
orthoMCL 1 0.900 - - OOG6_102292
Panther 1 1.100 - - O PTHR12403
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1852
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.