DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SsRbeta and AT5G14030

DIOPT Version :9

Sequence 1:NP_524103.2 Gene:SsRbeta / 39768 FlyBaseID:FBgn0011016 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001119221.1 Gene:AT5G14030 / 831251 AraportID:AT5G14030 Length:195 Species:Arabidopsis thaliana


Alignment Length:130 Identity:33/130 - (25%)
Similarity:59/130 - (45%) Gaps:1/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KHLLTLFALCAVFSTCLSEDETRARLLVSKQILNKYLVEKSDLLVRYTIFNVGSGAATKVRLVDS 67
            |.|::..|:..:.|...:..|....::..|..||:.......:.|.|.|:|.||.:|..|.|.|:
plant     7 KLLISAMAVFMLVSASFATSEVPFMVVHKKATLNRLKSGAERVSVSYDIYNQGSSSAYDVTLTDN 71

  Fly    68 GFHPEAFDVVGGQPTAVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEESETLQLAVSS 132
            .:..:.|:||.|..:...:|:......:|.:.:..|..|.|....|.|::: :.....||.|.|:
plant    72 SWDKKTFEVVNGNTSKSWERLDAGGILSHSIELEAKVKGVFYGAPAVVTFR-IPTKPALQEAYST 135

  Fly   133  132
            plant   136  135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsRbetaNP_524103.2 TRAP_beta 9..186 CDD:283423 31/124 (25%)
AT5G14030NP_001119221.1 TRAP_beta 13..192 CDD:399046 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3317
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2679
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1286165at2759
OrthoFinder 1 1.000 - - FOG0005573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105222
Panther 1 1.100 - - LDO PTHR12861
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.