DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SsRbeta and SSR2

DIOPT Version :9

Sequence 1:NP_524103.2 Gene:SsRbeta / 39768 FlyBaseID:FBgn0011016 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_003136.1 Gene:SSR2 / 6746 HGNCID:11324 Length:183 Species:Homo sapiens


Alignment Length:185 Identity:89/185 - (48%)
Similarity:122/185 - (65%) Gaps:4/185 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTLFALCAVFSTCLSEDETRARLLVSKQILNKYLVEKSDLLVRYTIFNVGSGAATKVRLVDSGFH 70
            |..|.:.|:|:  :::.|..||||.||.:||:|.||..||.::|.|:||||.||..|.|.|..|.
Human     3 LLSFVVLALFA--VTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFP 65

  Fly    71 PEAFDVVGGQPTAVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEESETLQLAVSSEPG 135
            ||.|.:|.|......|||||.:|.:|.:|:||...||||||:|.::|.|.|:...: :..:|.||
Human    66 PEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVV-IGSTSAPG 129

  Fly   136 EGGIVNLNEYNKRFSSHFFDWVAFAVMTLPSLAIPLALWHQSKSKYERSGKNKKH 190
            :|||:...|:::|||.||.||.||.||||||:.|||.||:.||.||: :.|.||:
Human   130 QGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYD-TPKTKKN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsRbetaNP_524103.2 TRAP_beta 9..186 CDD:283423 85/176 (48%)
SSR2NP_003136.1 TRAP_beta 4..179 CDD:310394 85/178 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157814
Domainoid 1 1.000 168 1.000 Domainoid score I3844
eggNOG 1 0.900 - - E1_KOG3317
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2369
Inparanoid 1 1.050 171 1.000 Inparanoid score I4109
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55840
OrthoDB 1 1.010 - - D1286165at2759
OrthoFinder 1 1.000 - - FOG0005573
OrthoInspector 1 1.000 - - oto88709
orthoMCL 1 0.900 - - OOG6_105222
Panther 1 1.100 - - LDO PTHR12861
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2819
SonicParanoid 1 1.000 - - X5211
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.