DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SsRbeta and Ssr2

DIOPT Version :9

Sequence 1:NP_524103.2 Gene:SsRbeta / 39768 FlyBaseID:FBgn0011016 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001099912.1 Gene:Ssr2 / 295235 RGDID:1308365 Length:183 Species:Rattus norvegicus


Alignment Length:186 Identity:90/186 - (48%)
Similarity:121/186 - (65%) Gaps:7/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLTLFALCAVFSTCLSEDETRARLLVSKQILNKYLVEKSDLLVRYTIFNVGSGAATKVRLVDSGF 69
            ::.:.||.||     |:.|..||||.||.:||:|.||..||.::|.|:||||.||..|.|.|..|
  Rat     5 VVVVLALLAV-----SQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSF 64

  Fly    70 HPEAFDVVGGQPTAVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEESETLQLAVSSEP 134
            .||.|.:|.|......|||||.:|.:|.:|:||...||||||:|.::|.|.|:...: :..:|.|
  Rat    65 PPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVV-IGSTSAP 128

  Fly   135 GEGGIVNLNEYNKRFSSHFFDWVAFAVMTLPSLAIPLALWHQSKSKYERSGKNKKH 190
            |:|||:...|:::|||.||.||.||.||||||:.|||.||:.||.||: :.|.||:
  Rat   129 GQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYD-TPKPKKN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsRbetaNP_524103.2 TRAP_beta 9..186 CDD:283423 87/176 (49%)
Ssr2NP_001099912.1 TRAP_beta 15..179 CDD:399046 83/165 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351779
Domainoid 1 1.000 169 1.000 Domainoid score I3709
eggNOG 1 0.900 - - E1_KOG3317
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2369
Inparanoid 1 1.050 170 1.000 Inparanoid score I4041
OMA 1 1.010 - - QHG55840
OrthoDB 1 1.010 - - D1286165at2759
OrthoFinder 1 1.000 - - FOG0005573
OrthoInspector 1 1.000 - - oto95840
orthoMCL 1 0.900 - - OOG6_105222
Panther 1 1.100 - - LDO PTHR12861
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5211
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.