DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SsRbeta and trap-2

DIOPT Version :9

Sequence 1:NP_524103.2 Gene:SsRbeta / 39768 FlyBaseID:FBgn0011016 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_508150.1 Gene:trap-2 / 180422 WormBaseID:WBGene00020216 Length:188 Species:Caenorhabditis elegans


Alignment Length:185 Identity:65/185 - (35%)
Similarity:107/185 - (57%) Gaps:5/185 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLFALCAVFSTCLS-EDETR-ARLLVSKQILNKYLVEKSDLLVRYTIFNVGSGAATKVRLVD-SG 68
            :||||..|..:|:. ..:|| |.:|..||.|:.|.||..|.::.|.::|||...|.||.:.| ..
 Worm     4 SLFALLFVVVSCVDVGTQTRDAFILAHKQPLSTYAVENMDFVLEYGLYNVGDKPAQKVTIDDRHS 68

  Fly    69 FHPEAFDVVGGQPTAVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEESETLQLAVSSE 133
            |...:||:|.|......::|...:|.||.:|:||:|||:||:|||:|:|  ..::|...:.:::.
 Worm    69 FPTNSFDIVKGLLFVHFEQIPAGSNVTHSVVIRPRAFGFFNYTAAQVTY--YTDNENHHVTLTNT 131

  Fly   134 PGEGGIVNLNEYNKRFSSHFFDWVAFAVMTLPSLAIPLALWHQSKSKYERSGKNK 188
            ||||.|....||::||:..:..::.|.::..|:......|:.|||:::....|.|
 Worm   132 PGEGYIYRQREYDRRFAPKYTYFLVFFLIVAPTTLGSFLLFQQSKARFPNVIKKK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsRbetaNP_524103.2 TRAP_beta 9..186 CDD:283423 62/179 (35%)
trap-2NP_508150.1 TRAP_beta 6..184 CDD:283423 62/179 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165733
Domainoid 1 1.000 102 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3317
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2369
Inparanoid 1 1.050 109 1.000 Inparanoid score I3471
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55840
OrthoDB 1 1.010 - - D1286165at2759
OrthoFinder 1 1.000 - - FOG0005573
OrthoInspector 1 1.000 - - oto17449
orthoMCL 1 0.900 - - OOG6_105222
Panther 1 1.100 - - LDO PTHR12861
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2819
SonicParanoid 1 1.000 - - X5211
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.