DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SsRbeta and K08F4.3

DIOPT Version :9

Sequence 1:NP_524103.2 Gene:SsRbeta / 39768 FlyBaseID:FBgn0011016 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_501843.1 Gene:K08F4.3 / 177881 WormBaseID:WBGene00010678 Length:182 Species:Caenorhabditis elegans


Alignment Length:199 Identity:53/199 - (26%)
Similarity:81/199 - (40%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTLFALCAVFSTCLSEDETRARLLVSKQILNKYLVEKSDLLVRYTIFNVGSGAATKVRLVD-SGF 69
            |.|.||.|.        :..|::|:.|..:.||.|.:.:....|.|.|:|...|.||.|.| ..|
 Worm     6 LILSALAAA--------DASAKILIGKSFVTKYPVAQRENAFEYQIINIGLSPALKVELSDLKSF 62

  Fly    70 HPEAFDVVGGQPTAVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEESETLQLAVSSEP 134
            ..:.|:::.|..||....|...:...|.:||.|:.            .:|:|:.:.......||.
 Worm    63 PTDRFEILKGSATASFPVIPANSTIYHHIVVIPRV------------PQAIEDHDVTVNYTDSET 115

  Fly   135 GEGGIVNLNEYNKRFSSHFF--------------DWVAFAVMTLPSLAIPLALWHQSKSKYERSG 185
            |:....:...|:||..:|||              .::.|..:..|..|||..|:..||.:|    
 Worm   116 GKRARTSTVSYDKRGYTHFFAETAMRKVEGVNCTHFLGFGAIAFPLTAIPAILYWISKRRY---- 176

  Fly   186 KNKK 189
            .|||
 Worm   177 SNKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsRbetaNP_524103.2 TRAP_beta 9..186 CDD:283423 48/191 (25%)
K08F4.3NP_501843.1 TRAP_beta 1..180 CDD:283423 51/197 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165734
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3317
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12861
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.