DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf4 and nht

DIOPT Version :9

Sequence 1:NP_001137958.1 Gene:Taf4 / 39765 FlyBaseID:FBgn0010280 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster


Alignment Length:180 Identity:55/180 - (30%)
Similarity:83/180 - (46%) Gaps:26/180 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   912 ACQERLKNIVEKLAVIAEHRIDV-IKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLR 975
            |.:..:|::|:|...:.|||... :..|.|.....|:|..:.||.:|:.|:...           
  Fly    86 ALETYMKHVVKKTIELCEHRTSYHLHNDERCVMKNDMRVTMMFLNDLEIADYGS----------- 139

  Fly   976 AAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKKLKLDGETVSSGAGSSG 1040
                    .|.|....:.|..|....|.:..|....|.|||.||..||:   .||.::..:..||
  Fly   140 --------SDDETGFYRKRRAENIDEERKVARLESVNDTALLAISGRKR---PGEQLAPESAPSG 193

  Fly  1041 GGVLSSSGSAP--TTLRPRIKRVNLRDMLFYMEQEREFCRSSMLFKTYLK 1088
            ..|...:| ||  ....||.|.:|:||:|.:||::|.:.||:|||:.|||
  Fly   194 SKVAKLTG-APIQRACAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf4NP_001137958.1 TAFH 460..550 CDD:197785
TAF4 842..1084 CDD:283017 51/174 (29%)
nhtNP_523574.4 TAF4 10..238 CDD:173965 51/174 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2341
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001841
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15138
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.