DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf4 and taf4

DIOPT Version :9

Sequence 1:NP_001137958.1 Gene:Taf4 / 39765 FlyBaseID:FBgn0010280 Length:1088 Species:Drosophila melanogaster
Sequence 2:NP_593109.1 Gene:taf4 / 2541721 PomBaseID:SPAC23G3.09 Length:365 Species:Schizosaccharomyces pombe


Alignment Length:330 Identity:76/330 - (23%)
Similarity:123/330 - (37%) Gaps:87/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   815 TSSGGAASAANSFFQQSSMSSMYGD----DDINDVAAMGGVNLAEESQRILGC--------TENI 867
            :||.|.||.              ||    |.:.|.....|:.|.||...:...        |..:
pombe    64 SSSVGVASG--------------GDRQEADQLQDALISCGIQLKEEELNLSTSFYDPSSLNTFAL 114

  Fly   868 GTQIRSCKDEVFLNLPSLQARIRAITSEAGLDEPSQDVAVLISHACQERLKNIVEKLAVIAEHRI 932
            .|:.||.|.: |||...|...:..|.:...|.....|:..|||.|.::.|.|:::|:.|.:.||.
pombe   115 TTEDRSRKSD-FLNSFVLMQTVSNIVNLHRLKSMDSDIHALISMAVRDYLANLLQKMIVESHHRT 178

  Fly   933 DVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKE 997
            ..:..| .|:...:||      :.|.....|.:|..||         |..|.:..:|:.:||..|
pombe   179 SQLHTD-NYKQVDNVR------QTLANFAYKEYESEER---------RRTVLNIRRAEHEARLAE 227

  Fly   998 MQRAEMEE-----LRQRDANLTALQAIGPRKKLKLDGETVSSGAGS---SGGGVLSSSGSAPTTL 1054
            :..|...|     .|:..::..|.:.|....:.::...|.|..|||   |||...|...:..|.:
pombe   228 LNSASTNEEGSSRRRKEQSSSAAAKNISEDAQNRMTNATASIMAGSALPSGGKKYSWMATDMTPM 292

  Fly  1055 RPRI-------KR-----------------------VNLRDMLFYMEQERE-----FCR-SSMLF 1083
            .|.:       |:                       :.:||.|..:|.:||     |.| :..:.
pombe   293 TPAVGGGFGIRKKDSNSLKPSSRDGVLPLQQEEKGIITIRDALAVLEMDREGAGRIFGRGAKAMM 357

  Fly  1084 KTYLK 1088
            :.|::
pombe   358 RAYIR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf4NP_001137958.1 TAFH 460..550 CDD:197785
TAF4 842..1084 CDD:283017 67/293 (23%)
taf4NP_593109.1 TAF4 81..360 CDD:283017 67/295 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.