DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf4 and LOC101886077

DIOPT Version :9

Sequence 1:NP_001137958.1 Gene:Taf4 / 39765 FlyBaseID:FBgn0010280 Length:1088 Species:Drosophila melanogaster
Sequence 2:XP_009299300.2 Gene:LOC101886077 / 101886077 -ID:- Length:252 Species:Danio rerio


Alignment Length:251 Identity:117/251 - (46%)
Similarity:154/251 - (61%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   775 RINASLTPIGAKTMARPPPAINKAIGKKKRDAMEMDAKLNTSSGGAASAANSFFQQSSMSSMYGD 839
            |...:|....|....|.|..:...:...:::      |||...||               :...|
Zfish    22 RTTGTLGKPAALQTGRCPAGVTIQLSANQKN------KLNDPGGG---------------TFRDD 65

  Fly   840 DDINDVAAMGGVNLAEESQRILGCTEN-IGTQIRSCKDEVFLNLPSLQARIRAITSEAGLDEPSQ 903
            |||||||:|.||||.|||.|||....: :||||||||||.||.:..|..||.......|:.:...
Zfish    66 DDINDVASMAGVNLNEESARILATNSDLVGTQIRSCKDEAFLPIGLLHRRILETAKRFGVTDVPL 130

  Fly   904 DVAVLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQKRHEEL 968
            :....||||.|.||:.::||::.||:||:|..|.|...||:.|||.|:||.|:|::.|::|.:|.
Zfish   131 EAVNFISHATQSRLRTVLEKVSSIAQHRMDSCKEDEWCEPSSDVRAQLKFFEQLERMEKQRKDER 195

  Fly   969 EREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRKK 1024
            |||:||||||||||.||||||::|.:|||||:.|:.::||||||||||.|||||||
Zfish   196 EREILLRAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf4NP_001137958.1 TAFH 460..550 CDD:197785
TAF4 842..1084 CDD:283017 104/184 (57%)
LOC101886077XP_009299300.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D322413at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.