DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and Stau1

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_445888.1 Gene:Stau1 / 84496 RGDID:621778 Length:495 Species:Rattus norvegicus


Alignment Length:317 Identity:58/317 - (18%)
Similarity:100/317 - (31%) Gaps:98/317 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GAGGYGGYGDYRSAMQYDATKTFYQQSPASYNASGSTASVSKTHYSAP-PVKNQVKGKMDKSNGG 127
            |...:.|.|..|..:::||                 ||...:|..|.| |.:.:|.|:..:....
  Rat    46 GGQQFNGKGKMRPPVKHDA-----------------TARALRTLQSEPLPERLEVNGRESEEENL 93

  Fly   128 PKPPSSAPPAGNNYSGYDTAL-----YNAASMYVAQ--QHQGNPNQK-------------PNGGA 172
            .|...|        ..::.||     .|..|..:.|  :..|.|:.|             ...|.
  Rat    94 NKSEIS--------QVFEIALKRNLPVNFESFPLTQVARESGPPHMKNFVTRVSVGEFVGEGEGK 150

  Fly   173 NNWYQRKMGA--------TIPGATAIRGMRPKAPPRPQQLHYCEVCKISCAGPQTYREHLEG--- 226
            :....:|..|        .:|...|:..::|:...:.|     ..||:     ||..::.:|   
  Rat   151 SKKISKKNAARAVLEQLRRLPPLPAVERVKPRIKKKSQ-----PTCKL-----QTAPDYGQGMNP 205

  Fly   227 -------QKHKKREASLKMSASANSATQNRGNNYHCELCDVTCTGTDAYAAHVRGAKHQKVVKLH 284
                   |:.||.:....|..:.....:.|......::...|..|.   ..:.:.||......:.
  Rat   206 ISRLAQIQQAKKEKEPEYMLLTERGLPRRREFVMQVKVGHHTAEGA---GTNKKVAKRNAAENML 267

  Fly   285 QKLGKPIPSEEP-------------KKMG---KINFVPAAAGGAGVAKTEGGANESD 325
            :.||..:|..:|             ||.|   |:.|...:.|     ...|.:|:.|
  Rat   268 EILGFKVPQAQPAKPALKSEEKTPVKKPGDGRKVTFFEPSPG-----DENGTSNKED 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732 8/40 (20%)
C2H2 Zn finger 207..229 CDD:275371 6/31 (19%)
ZnF_U1 252..284 CDD:197732 4/31 (13%)
C2H2 Zn finger 255..277 CDD:275371 3/21 (14%)
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842
Stau1NP_445888.1 DSRM_SF 1..70 CDD:412133 8/40 (20%)
DSRM_SF 95..167 CDD:412133 13/79 (16%)
DSRM_STAU1_rpt4 194..279 CDD:380714 15/87 (17%)
Staufen_C 366..475 CDD:374568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.