DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and AT5G61180

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_001318852.1 Gene:AT5G61180 / 836239 AraportID:AT5G61180 Length:374 Species:Arabidopsis thaliana


Alignment Length:95 Identity:24/95 - (25%)
Similarity:43/95 - (45%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 YCEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYH--CELCDVTCTGTDAY 268
            :||:|.:||:. .....||.|::|:   |::::.|.......|.....:  |.:|.:......:|
plant   286 FCELCNVSCSN-HDLTAHLSGRRHR---ANVELVARGRPLVSNSTEPKYAWCRVCRLRFRSQASY 346

  Fly   269 AAHVRGAKHQKVVKLHQKLGKPIPSEEPKK 298
            ..|:.|..||:  ||..:      :|..||
plant   347 ETHILGKSHQE--KLEDQ------NEHSKK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732 10/29 (34%)
C2H2 Zn finger 207..229 CDD:275371 8/21 (38%)
ZnF_U1 252..284 CDD:197732 8/33 (24%)
C2H2 Zn finger 255..277 CDD:275371 5/21 (24%)
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842
AT5G61180NP_001318852.1 PIN_limkain_b1_N_like 81..223 CDD:350234
ZnF_U1 286..315 CDD:197732 10/32 (31%)
C2H2 Zn finger 287..308 CDD:275371 8/21 (38%)
ZnF_U1 332..362 CDD:197732 9/31 (29%)
C2H2 Zn finger 333..355 CDD:275371 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D612611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.