DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and Adad2

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_083704.1 Gene:Adad2 / 75773 MGIID:1923023 Length:561 Species:Mus musculus


Alignment Length:181 Identity:40/181 - (22%)
Similarity:59/181 - (32%) Gaps:47/181 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 KSNGGPKPPSSAPPAGNNYSGYDTALYNAASMYVAQQHQ----GNPNQKPNGGANNWYQRKMGAT 183
            |.:||.:|..:...|..      ||.:..|....|.:..    |.....| |.|.::        
Mouse    26 KPSGGQEPTEAGDAAPR------TAEHGVAGAQEAHREACKALGGSVLSP-GPAGDF-------- 75

  Fly   184 IPGATAIRGMRPKAPPRPQQLHYCEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQN 248
             |||.....|.||.||..|.:.....|..:.....|:   ||.|                  |..
Mouse    76 -PGALHGLSMLPKDPPPAQAVALLTQCMANLGVSLTF---LEDQ------------------TAG 118

  Fly   249 RGNNYH--CELCDVTC-TGTDAYAAHVRGAKHQKVVKLHQKLGKPIPSEEP 296
            .|:::.  .:|..:.| .||.:....   ||.|..:...|.:.|.:...||
Mouse   119 PGSSFSVCADLDGLVCPAGTGSSKLE---AKQQAALSALQYIQKQLERPEP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732 5/30 (17%)
C2H2 Zn finger 207..229 CDD:275371 5/21 (24%)
ZnF_U1 252..284 CDD:197732 7/34 (21%)
C2H2 Zn finger 255..277 CDD:275371 5/22 (23%)
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842
Adad2NP_083704.1 DSRM 101..157 CDD:238007 15/79 (19%)
A_deamin 239..554 CDD:280326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.