DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and adad2

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:XP_687183.1 Gene:adad2 / 558824 ZFINID:ZDB-GENE-130530-788 Length:517 Species:Danio rerio


Alignment Length:163 Identity:38/163 - (23%)
Similarity:63/163 - (38%) Gaps:45/163 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   625 LKEVAGDTQVNYRV-EVNAEEAALIVLDESVSVKIT---------LTSP-----LLRDANPGEAA 674
            |.:|.|.:.|.::. ||.:.::...:.|...|..:|         :|:|     ||.||..| :.
Zfish    68 LDDVEGQSSVGHQTQEVQSPDSPPQMEDLGSSSDVTSLSGWSLSSVTAPEATVDLLEDATDG-SL 131

  Fly   675 TTDEGEGDSEFLPREPCLRALADLRHAKWFQARATGLQSCV-MVIRILRDLCQRVSSWQSLPQWS 738
            |.|:..|                ::.|.|.:.|.|.|  |. ...::||: |....|.:|.   .
Zfish   132 TRDQRTG----------------VKFADWHKNRVTAL--CTGRFDKLLRE-CPEYHSTKSC---F 174

  Fly   739 LELLVEKVISSAGFPISPGD-CMRRIMEALSSG 770
            ...::|:.:...|     |. |....:.||.||
Zfish   175 AAFVLEREVRDTG-----GQRCENYEVVALGSG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732
C2H2 Zn finger 207..229 CDD:275371
ZnF_U1 252..284 CDD:197732
C2H2 Zn finger 255..277 CDD:275371
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842 38/163 (23%)
adad2XP_687183.1 A_deamin 198..509 CDD:280326 4/5 (80%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.