DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and adarb2

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:XP_686426.5 Gene:adarb2 / 558149 ZFINID:ZDB-GENE-060503-160 Length:740 Species:Danio rerio


Alignment Length:468 Identity:89/468 - (19%)
Similarity:133/468 - (28%) Gaps:165/468 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GTQY----NTGQVSYPAVTNATYANAAAYQNAAVAAGQGGYGGAAGAGAGATSGPGAGGYGGYGD 73
            |.||    .||.|..|..:.|...|...::                 |.|.|...        ..
Zfish   138 GLQYRMVSQTGPVHAPLFSIAVEVNGLTFE-----------------GTGPTKKK--------AK 177

  Fly    74 YRSAMQYDATKTFYQQSPASY------NASGSTASVSKTHYSAPPVKNQVKGKMDKSNGGPKPPS 132
            .::|..  |.|:|.|...||.      ..|..||..:......|  ....||         ..|.
Zfish   178 MKAAEM--ALKSFIQFPNASQAHLAMGGLSNPTADFTSDQADFP--DTLFKG---------FEPD 229

  Fly   133 SAPPAGNNYSGYDTALYNAASMYVAQQHQGNPNQKPNGGANNWYQRKMGATIPGATAIRGMRPKA 197
            ....|.|........|.:...:.|.|..|.:|                  .:|.|       |.:
Zfish   230 GCRSAENELLSSALRLRHTLDLMVVQARQEDP------------------CLPPA-------PVS 269

  Fly   198 PPRPQQ----------LHYCEVCKISCA-GPQTYREHL----------EGQKHKKREASLKMSAS 241
            ||:|..          |.|  .|....| |.:.:|..:          ||....|::|..:.:..
Zfish   270 PPQPSPVVLLNDLRPGLRY--ACLSEHAQGKRAHRSFIMAVRVDGRIFEGSGRSKKQAKRQAAVC 332

  Fly   242 ANSATQNRGNNYHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQKLGKPIPSEEPKKMGKI---- 302
            |..|..|            .....:|.|.|  .....|...|.|:....|.....:|..::    
Zfish   333 ALQALFN------------FRLAPEARAGH--RPSRIKCPHLPQEFADGIFQLVREKYSELAGCS 383

  Fly   303 NFVPAAAGG-AGVAKTEGGANESDAAGDLDDNLDDSLGENTDNIKPVGGEYIEEVKDEEGKILSF 366
            :.:.|...| ||:..|.|        .||......:|...|   |.:.||||    .::|.::: 
Zfish   384 SLLHARHKGLAGIVMTRG--------LDLRHAQVVALSSGT---KCINGEYI----SDQGLVVN- 432

  Fly   367 NCKLCDCKFNDPNAK----------EMHMKGR----------RHR---LQYKRKVQPDLVVDFKP 408
                 ||.......:          |:|:..|          ||:   |:.:..|...:.:...|
Zfish   433 -----DCHAEITTRRALLRFLYSQLELHLSKRKEDWEQSIFVRHKDSCLRLRENVLFHMYISTSP 492

  Fly   409 TPRQRRLAEARAN 421
                  ..:||.|
Zfish   493 ------CGDARVN 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732 9/41 (22%)
C2H2 Zn finger 207..229 CDD:275371 6/32 (19%)
ZnF_U1 252..284 CDD:197732 4/31 (13%)
C2H2 Zn finger 255..277 CDD:275371 3/21 (14%)
ZnF_U1 368..396 CDD:197732 8/50 (16%)
C2H2 Zn finger 368..390 CDD:275371 5/41 (12%)
DZF 577..829 CDD:128842
adarb2XP_686426.5 DSRM 125..>172 CDD:214634 11/50 (22%)
dsrm 278..337 CDD:278464 11/60 (18%)
ADEAMc 364..737 CDD:214718 31/163 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594020
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.