DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and CG5641

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster


Alignment Length:446 Identity:111/446 - (24%)
Similarity:175/446 - (39%) Gaps:95/446 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 GAQRFGRMGNGPPPHFGMMPGGNVRRPESTDDRHAIARH------AEI-YPKEEELQTIQRIVSH 520
            ||.|.||          .|.|| :|.|..   :..:.||      ||: :||             
  Fly     4 GALRGGR----------PMRGG-IRPPFK---KTFVPRHPFDLTLAEVFFPK------------- 41

  Fly   521 TERALKLVSDALAEQPSDAGAA---NKKDKAEKPSEKDGRDNQIFSFQKDADN-----GGNVVRI 577
                   |..|.|...|...||   ..:|.:..|||:....|.:...|...||     |......
  Fly    42 -------VPSAGAVDDSALTAALLKRNQDLSPTPSEQTAIGNLVTKVQAVLDNLVVAPGDLTTCQ 99

  Fly   578 LKGVMRVGYLAKGLLLHGDNAVELVVLCAEKPTSGLLQRVANVLPDKLKEVAGDTQVNYRVE--- 639
            |:.|.:||...||.:|.|:|..::||:....||...:..:|       |:|..|.:.:.:.|   
  Fly   100 LEEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVDALA-------KKVEADLKASMKTEVLT 157

  Fly   640 ------VNAEEAALIVLDESVSVKITL-TSPL-LRDANPGEAATTDEGEGDSEFLPREPCLRALA 696
                  |...|....:.:....|:|.: |.|. ||...|       |...|.:.:...     ||
  Fly   158 KGDQHTVQIHERGFDIANVHAKVRILIATLPQNLRKLEP-------EIHLDHKLMQSH-----LA 210

  Fly   697 DLRHAKWFQARATGLQSCVMVIRILRDLCQRVSSWQSLPQWSLELLVEKVI----SSAGFPISPG 757
            .:||.:||:..|.. .|..::||||:||.:|..::..|..|.|:|:....|    |....||:. 
  Fly   211 AIRHTRWFEENAHH-SSIKVLIRILKDLTRRFDAFSPLSAWMLDLIAHLAIMNNPSRQALPINL- 273

  Fly   758 DCMRRIMEALSSG-FLINGPGLLDPCEKDPTDALLELTKQEREDLTVSAQLFLRYIAFRQIYKVL 821
             ..||:.:.||:| ||....|:.||.|.........:|.::::....::|..||.:|......:|
  Fly   274 -AFRRVFQLLSAGLFLPGSAGITDPTEPGHIRVHTAMTLEQQDVCCYTSQTLLRVLAHGGYKHIL 337

  Fly   822 GMEPLPAMKFPMRPWR------VNRKRRRSSGKAGGAPGTETE--SNDIDETGSDE 869
            |:|...::...|..|.      :.....:.:.|..|....:.:  .|:.:|.|||:
  Fly   338 GLEGNTSVVREMSVWNGVCISPLTAVYEKPTDKKEGDLEEDIDMIENENEEEGSDD 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732
C2H2 Zn finger 207..229 CDD:275371
ZnF_U1 252..284 CDD:197732
C2H2 Zn finger 255..277 CDD:275371
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842 71/267 (27%)
CG5641NP_650196.1 DZF 105..345 CDD:284860 69/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467860
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3792
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.