DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and ilf2

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_998401.1 Gene:ilf2 / 406517 ZFINID:ZDB-GENE-040426-2345 Length:387 Species:Danio rerio


Alignment Length:310 Identity:86/310 - (27%)
Similarity:142/310 - (45%) Gaps:30/310 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 LKLVSDALAEQPSDAGAANKKDKAEKPSEKDGRDNQIFSFQKDADN----GGNVVRILKGVMRVG 585
            :|..||..|.  |:......:|.:..|||:....:.:.......||    .||....::.|.:||
Zfish    44 VKPASDETAF--SECLLKRNQDLSPTPSEQASILSLVTKINNVIDNLIVAPGNFEVQIEEVRQVG 106

  Fly   586 YLAKGLLLHGDNAVELVVLCAEKPTSGLLQRVANVLPDKLKEVAGDTQVNYRVEVNAEEAALIVL 650
            ...||.:..|.|..:|||:....||   |:.|| .|.:|:.|.......:..:.:...|....:.
Zfish   107 SYKKGTMTAGHNVADLVVILKILPT---LEAVA-ALGNKVVETLRTQDPSEVLSMLTNETGFEIS 167

  Fly   651 DESVSVKITLTS--PLLRDANPGEAATTDEGEGDSEFLPREPCLRALADLRHAKWFQARATGLQS 713
            ....:|||.:|:  |.||..:|       |...|.:.|.     .|||.:|||:||:..|:  ||
Zfish   168 SADATVKILITTVPPNLRKLDP-------ELHLDIKVLQ-----SALAAIRHARWFEENAS--QS 218

  Fly   714 CVMV-IRILRDLCQRVSSWQSLPQWSLELLVEKVISS--AGFPISPGDCMRRIMEALSSG-FLIN 774
            .|.| ||:|:|:..|...::.|..|.|:||....:.:  :..|:......||.::.|::| ||..
Zfish   219 TVKVLIRLLKDIRVRFPGFEPLTPWILDLLGHSAVMNHPSRQPLPLNVAYRRCLQMLAAGLFLPG 283

  Fly   775 GPGLLDPCEKDPTDALLELTKQEREDLTVSAQLFLRYIAFRQIYKVLGME 824
            ..|:.||||.........:|.::::.:..:||..:|.::.....|:||:|
Zfish   284 SVGITDPCESGNFRVHTVMTLEQQDMVCFTAQTLVRVLSHGGYRKILGLE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732
C2H2 Zn finger 207..229 CDD:275371
ZnF_U1 252..284 CDD:197732
C2H2 Zn finger 255..277 CDD:275371
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842 73/254 (29%)
ilf2NP_998401.1 DZF 98..338 CDD:128842 73/254 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..387
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.