DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and blanks

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster


Alignment Length:326 Identity:63/326 - (19%)
Similarity:125/326 - (38%) Gaps:63/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   588 AKGLLLHGDNAVELVVLCAEK---PTSGLLQRVANVLP--DKLKEVA--GDTQVNYRVEVNAEEA 645
            ||.||  .::..::.:|..:|   |.....:....|:|  |.||:.|  |:.:.:.:..|::|..
  Fly     3 AKQLL--AESCAKVDILEMKKALIPNPSAEEDAVAVIPLADNLKKTAMGGENKSDEKGTVSSEPK 65

  Fly   646 ALIVLDESVSVKITLTSPLLRDANPGEAATTDEGEGDSEFLPREPCLRALADLRHAKWFQARATG 710
            |   |.:.::..:.:|...:.|....:..|.|...|..               :..|..:|:...
  Fly    66 A---LSDQITSSMRVTKNKIADDKSSDVITDDATNGRK---------------KQKKNKKAKIRP 112

  Fly   711 L------QSCVMVIRILRDLCQRVSSWQSLPQWSLELLVEKVISSAGFPISPGD--------CMR 761
            |      :..:||:..|:.:  .|.:.|.......:::...|::|..:......        |.:
  Fly   113 LTMPVTSKDALMVLNELKGV--TVDNMQIKRDHEGKIMARVVVNSKKYEAEGSSVNSARNAACEK 175

  Fly   762 RIMEALSSGF--LINGPGLL------DPCEKDPTDALLELTKQEREDLTVSAQLFLRYIAFRQIY 818
            .:.|.|::..  :::|||..      |..||..:.|:.:|.::.:.|....|.|: ..:..:|..
  Fly   176 ALQEILTTKMKAVLDGPGKSLESDEDDILEKMASYAIHKLGEEWKTDDIDVATLY-NDLKNKQTS 239

  Fly   819 KVLGMEPLPAMKFPMRPWRV-NRKRRRSSGKAGGAPGTE----------TESNDIDETGSDEKVA 872
            .|...:|||.....|.|..| |..|.:.:....|..||.          .::.:.:..|..:|.|
  Fly   240 VVEPKKPLPETWKNMHPCMVLNYMRPQCTFIVSGGTGTNQNNTFSMSVCVDNCEFNAEGPSKKAA 304

  Fly   873 K 873
            :
  Fly   305 R 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732
C2H2 Zn finger 207..229 CDD:275371
ZnF_U1 252..284 CDD:197732
C2H2 Zn finger 255..277 CDD:275371
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842 52/269 (19%)
blanksNP_647966.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.