powered by:
Protein Alignment Zn72D and Adat1
DIOPT Version :9
Sequence 1: | NP_001261924.1 |
Gene: | Zn72D / 39764 |
FlyBaseID: | FBgn0263603 |
Length: | 884 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001260450.1 |
Gene: | Adat1 / 34787 |
FlyBaseID: | FBgn0028658 |
Length: | 394 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 16/64 - (25%) |
Similarity: | 29/64 - (45%) |
Gaps: | 19/64 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 362 KILSFNCKLC---DCKFNDPN----------AKEMHMKGR----RHRLQYKRKVQPDLVVDFKP 408
:::.||.||. |.:.:||. |::.....| ::.||:.:| |..::||.|
Fly 329 ELVKFNPKLSEMFDQQLSDPERIAYASCKDLARDYQFAWREIKEKYFLQWTKK--PHELLDFNP 390
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45467851 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.