DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and loqs

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_609646.1 Gene:loqs / 34751 FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster


Alignment Length:261 Identity:52/261 - (19%)
Similarity:88/261 - (33%) Gaps:77/261 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 YQQSPASYNASGSTASVSKTHYSAPPVKNQVKGKMDKSNGGPKPPSSAPPAGNNYSGYDTALYNA 151
            ::.....:.|.|:..|..:..::|      .:..:||..|...|.|.:..||.:.:|...|    
  Fly   173 FKDKDTPFTAMGAGRSKKEAKHAA------ARALIDKLIGAQLPESPSSSAGPSVTGLTVA---- 227

  Fly   152 ASMYVAQQHQGNPNQKPNGGANN--------WYQRKMGATIPGATAIRGMRPKAPP--------- 199
                 .....||.|....|.|::        |.|...            |:.:.||         
  Fly   228 -----GSGGDGNANATGGGDASDKTVGNPIGWLQEMC------------MQRRWPPPSYETETEV 275

  Fly   200 -RPQQLHYCEVCKISCAGPQTYREHLEGQKHK--KREASLKMSASANSATQNRG----------- 250
             .|.:..:...|.|     ..|||..:|:..|  ||.|:.:|.........:.|           
  Fly   276 GLPHERLFTIACSI-----LNYREMGKGKSKKIAKRLAAHRMWMRLQETPIDSGKISDSICGELE 335

  Fly   251 ------NNYHCELCDVTC-TGTDAYAAHV-------RGAKHQKVVKLHQKLGKPIPSEEPKKMGK 301
                  .||:.||.|::. |.|..::..|       :.|..:|::||.:...|....:..|.:|:
  Fly   336 GEPRSSENYYGELKDISVPTLTTQHSNKVSQFHKTLKNATGKKLLKLQKTCLKNNKIDYIKLLGE 400

  Fly   302 I 302
            |
  Fly   401 I 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732 10/32 (31%)
C2H2 Zn finger 207..229 CDD:275371 6/21 (29%)
ZnF_U1 252..284 CDD:197732 11/39 (28%)
C2H2 Zn finger 255..277 CDD:275371 7/29 (24%)
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842
loqsNP_609646.1 DSRM 136..204 CDD:214634 5/36 (14%)
DSRM 250..316 CDD:238007 17/82 (21%)
DSRM 394..460 CDD:214634 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.