DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and tarbp2

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_956291.1 Gene:tarbp2 / 336141 ZFINID:ZDB-GENE-030131-8085 Length:346 Species:Danio rerio


Alignment Length:280 Identity:55/280 - (19%)
Similarity:82/280 - (29%) Gaps:107/280 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 NGGANNWYQ--RKMGATIPGATAIR---------GMRP-----KAPPRPQQLHY---CEVCKISC 214
            ||..|:.|.  .:|.|..||.|.|.         |..|     ||..:..|.::   ..|..|:|
Zfish     9 NGKRNSGYTSIEQMLAVNPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVSVGDINC 73

  Fly   215 AGPQTYREHLEGQKHKKREASLKM-----------------------------------SASANS 244
            .|   :....:..|||..||:|||                                   |:|...
Zfish    74 TG---HGPSKKAAKHKAAEAALKMLKGGMLGGIGGNGMEGDGFVGIEMEGECPQSEMKSSSSTQQ 135

  Fly   245 A------------------------TQNRGNNYHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQ 285
            |                        ||..|..:..|. .:||             :.::.|::..
Zfish   136 AECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEF-TMTC-------------RVERFVEIGS 186

  Fly   286 KLGKPIPSEE--PKKMGKINFVPAAAGGAGVAKTEGGANESDAAGDLDDNLDDSLGENTDNIKPV 348
            ...|.:....  .|.:.:|:.||.....:..|:.|.........|.|:......||...|:::..
Zfish   187 GTSKKLAKRNAAAKMLSRIHDVPVDMRSSHEAEAEDDTFNMQIGGRLEGGKSKGLGCTWDSLRNS 251

  Fly   349 GGEYIEEVKDEEGKILSFNC 368
            .||          |||...|
Zfish   252 AGE----------KILQLRC 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732 9/33 (27%)
C2H2 Zn finger 207..229 CDD:275371 4/21 (19%)
ZnF_U1 252..284 CDD:197732 4/31 (13%)
C2H2 Zn finger 255..277 CDD:275371 3/21 (14%)
ZnF_U1 368..396 CDD:197732 1/1 (100%)
C2H2 Zn finger 368..390 CDD:275371 1/1 (100%)
DZF 577..829 CDD:128842
tarbp2NP_956291.1 DSRM 31..>79 CDD:214634 10/50 (20%)
DSRM 139..202 CDD:238007 9/76 (12%)
Staufen_C <278..325 CDD:293091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594002
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.