DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and Ilf2

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:XP_038958228.1 Gene:Ilf2 / 310612 RGDID:1305734 Length:511 Species:Rattus norvegicus


Alignment Length:392 Identity:102/392 - (26%)
Similarity:163/392 - (41%) Gaps:58/392 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NGPPPHFGMMPGGNVRRPESTD----DRHAIA------------------RHAEIYPKEEELQTI 514
            ||..||..:: |..:.||....    .||.:|                  .:.|:. ..|:|:..
  Rat    82 NGGKPHRDIL-GSRITRPTGIKPLCLPRHILAYDWLAQSLLGIVIGSISLAYNELL-MMEKLKGF 144

  Fly   515 QRIVSH-------TERALKLVSDALAEQP-SDAGAANKKDKAEKPSEKDGRDNQIFSFQKDADN- 570
            :..|.|       .|.|...|..|..|.. |:|.....:|.|...:|:....:.:.......|| 
  Rat   145 RPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNL 209

  Fly   571 ----GGNVVRILKGVMRVGYLAKGLLLHGDNAVELVVLCAEKPTSGLLQRVANVLPDKLKEVAGD 631
                |...|:| :.|.:||...||.:..|.|..:|||:....||...:..:.|.:.:.|:  |.|
  Rat   210 IVAPGTFEVQI-EEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLR--AQD 271

  Fly   632 TQVNYRVEVNAEEAALIVLDESVSVKITLTSPLLRDANPGEAATTDEGEGDSEFLPREPCLRALA 696
            ......:..|.....:...|.:|.:.||...|.||..:|       |...|.:.|.     .|||
  Rat   272 PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDP-------ELHLDIKVLQ-----SALA 324

  Fly   697 DLRHAKWFQARATGLQSCVMV-IRILRDLCQRVSSWQSLPQWSLELLVEKVI--SSAGFPISPGD 758
            .:|||:||:..|:  ||.|.| ||:|:||..|...::.|..|.|:||....:  :....|::...
  Rat   325 AIRHARWFEENAS--QSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNV 387

  Fly   759 CMRRIMEALSSG-FLINGPGLLDPCEKDPTDALLELTKQEREDLTVSAQLFLRYIAFRQIYKVLG 822
            ..||.::.|::| ||....|:.||||.........:|.::::.:..:||..:|.::.....|:||
  Rat   388 AYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILG 452

  Fly   823 ME 824
            .|
  Rat   453 QE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732
C2H2 Zn finger 207..229 CDD:275371
ZnF_U1 252..284 CDD:197732
C2H2 Zn finger 255..277 CDD:275371
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842 73/252 (29%)
Ilf2XP_038958228.1 DZF 219..459 CDD:128842 73/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.