DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and Prkra

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:XP_030106794.1 Gene:Prkra / 23992 MGIID:1344375 Length:365 Species:Mus musculus


Alignment Length:221 Identity:48/221 - (21%)
Similarity:77/221 - (34%) Gaps:43/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 GGAQRFGRMG-------NGP-PPHFGMMP--GGN---VRRPESTDDRHAIARHAEIYPKEEELQT 513
            |||:|.||.|       .|| .|.|...|  ||.   :|........||...:...:....::.|
Mouse     5 GGAERLGREGVWPALPRRGPASPSFSSCPLAGGRQAAIRGASKRQRGHAPLGNWPTWRGRTQIHT 69

  Fly   514 IQRIVSHTERALKLVSDALAEQPSDAGAANKKDKAEKPSEKDGRDNQIFSFQK--DADNGGNVVR 576
                           |.....|||....::.:.:||.| .....|:..||..|  .|..|...::
Mouse    70 ---------------SLDCCGQPSLLAMSHSRHRAEAP-PLQREDSGTFSLGKMITAKPGKTPIQ 118

  Fly   577 ILKGVMRVGYLAKGLLLHGDNAVELVVLCAEKPTSGLLQRVANVLPDKLKEVAGDTQVNYRVEVN 641
            :|.   ..|...|.:.::.....::.|   ..||......|.::      ...|:.......:..
Mouse   119 VLH---EYGMKTKNIPVYECERSDVQV---HVPTFTFRVTVGDI------TCTGEGTSKKLAKHR 171

  Fly   642 AEEAALIVLDESVSVKITLTSPLLRD 667
            |.|||:.:|..:.|:...:..||:.|
Mouse   172 AAEAAINILKANASICFAVPDPLMPD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732
C2H2 Zn finger 207..229 CDD:275371
ZnF_U1 252..284 CDD:197732
C2H2 Zn finger 255..277 CDD:275371
ZnF_U1 368..396 CDD:197732
C2H2 Zn finger 368..390 CDD:275371
DZF 577..829 CDD:128842 17/91 (19%)
PrkraXP_030106794.1 DSRM_PRKRA_rpt1 113..183 CDD:380718 14/81 (17%)
DSRM_PRKRA_rpt2 207..273 CDD:380720
DSRM_SF 320..>350 CDD:381777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.