DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zn72D and Tarbp2

DIOPT Version :9

Sequence 1:NP_001261924.1 Gene:Zn72D / 39764 FlyBaseID:FBgn0263603 Length:884 Species:Drosophila melanogaster
Sequence 2:NP_033345.2 Gene:Tarbp2 / 21357 MGIID:103027 Length:365 Species:Mus musculus


Alignment Length:408 Identity:75/408 - (18%)
Similarity:126/408 - (30%) Gaps:122/408 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GAGATSG-------------PGAGGYGGYGDYRSAM----QYDATKTFYQQSPASYNASGSTASV 103
            |:|.|:|             ||........:|.:.:    .||..|...|....::....:....
Mouse     7 GSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDT 71

  Fly   104 SKTHYSAPPVKNQVKGK-----MDKSNGGPKPPSSAPPAGNNYSGYDTALYNAASMYVAQQHQGN 163
            |.|  ...|.|...|.|     :....||    |...||..:.|.:  :|.:::.          
Mouse    72 SCT--GQGPSKKAAKHKAAEVALKHLKGG----SMLEPALEDSSSF--SLLDSSP---------- 118

  Fly   164 PNQKPNGGANNWYQRKMGATIPGATAIRG--MRPKAPPRPQQLHYCEVCKISCAGPQTYREHLEG 226
            |...|...|      :..|.:|.|...|.  |..:.|..|||         |...|....:.|..
Mouse   119 PEDTPVVAA------EAAAPVPSAVLTRSPPMEMQPPVSPQQ---------SECNPVGALQELVV 168

  Fly   227 QKHKKREASLKMSASANSATQNRGNNYHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQKLGKPI 291
            ||..:....:        .||..|..:..|. .:||             :.::.:::.....|.:
Mouse   169 QKGWRLPEYM--------VTQESGPAHRKEF-TMTC-------------RVERFIEIGSGTSKKL 211

  Fly   292 PSEE--PKKMGKINFVPAAAGGAGVAKTEGGANESDAAGDLD-----------DNLDDSLGENTD 343
            ....  .|.:.:::.||..|.....|:.:........:..||           |:|.:|:||...
Mouse   212 AKRNAAAKMLLRVHTVPLDARDGNEAEPDDDHFSIGVSSRLDGLRNRGPGCTWDSLRNSVGEKIL 276

  Fly   344 NIK--PVGG---------EYIEEVKDEEGKILSF-------NCKLCDCK-----------FNDPN 379
            :::  .||.         ..:.|:.:|:...:|:       ...||.|.           :....
Mouse   277 SLRSCSVGSLGALGSACCSVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCYGSAT 341

  Fly   380 AKEMHMKGRRHR-LQYKR 396
            .:|.......|| |||.|
Mouse   342 TREAARGDAAHRALQYLR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zn72DNP_001261924.1 ZnF_U1 205..236 CDD:197732 5/30 (17%)
C2H2 Zn finger 207..229 CDD:275371 4/21 (19%)
ZnF_U1 252..284 CDD:197732 3/31 (10%)
C2H2 Zn finger 255..277 CDD:275371 3/21 (14%)
ZnF_U1 368..396 CDD:197732 9/39 (23%)
C2H2 Zn finger 368..390 CDD:275371 4/32 (13%)
DZF 577..829 CDD:128842
Tarbp2NP_033345.2 Sufficient for interaction with PRKRA. /evidence=ECO:0000255|HAMAP-Rule:MF_03034 22..105 17/88 (19%)
DSRM_TARBP2_rpt1 27..98 CDD:380719 13/72 (18%)
Sufficient for interaction with PRKRA. /evidence=ECO:0000255|HAMAP-Rule:MF_03034 151..233 19/112 (17%)
DSRM_TARBP2_rpt2 158..224 CDD:380681 12/87 (14%)
Sufficient for interaction with DICER1. /evidence=ECO:0000255|HAMAP-Rule:MF_03034 227..365 26/133 (20%)
Sufficient for interaction with PRKRA. /evidence=ECO:0000255|HAMAP-Rule:MF_03034 286..365 13/74 (18%)
DSRM_TARBP2_rpt3 291..362 CDD:380722 13/69 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.